Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus PS/HR protein

This Virus PS/HR protein spans the amino acid sequence from region 18-279aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein B5

UniProt

P24083

Expression Region

18-279aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Lister) (VACV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-452-5p antagomir
HY-RI04475A-01 5 nmol

Rno-miR-452-5p antagomir

Sign In for Pricing
View Details
Rno-miR-452-5p antagomir
HY-RI04475A-02 20 nmol

Rno-miR-452-5p antagomir

Sign In for Pricing
View Details
TMSB4Y (Thymosin beta-4, Y-chromosomal, TB4Y) (MaxLight 490)
134531-ML490 100 µL

TMSB4Y (Thymosin beta-4, Y-chromosomal, TB4Y) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila subsp. pneumophila Probable intracellular septation protein A (lpg1293)
MBS7038293-01 0.02 mg

Recombinant Legionella pneumophila subsp. pneumophila Probable intracellular septation protein A (lpg1293)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila subsp. pneumophila Probable intracellular septation protein A (lpg1293)
MBS7038293-02 0.1 mg

Recombinant Legionella pneumophila subsp. pneumophila Probable intracellular septation protein A (lpg1293)

Sign In for Pricing
View Details
Recombinant Legionella pneumophila subsp. pneumophila Probable intracellular septation protein A (lpg1293)
MBS7038293-03 5x 0.1 mg

Recombinant Legionella pneumophila subsp. pneumophila Probable intracellular septation protein A (lpg1293)

Sign In for Pricing
View Details