Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus GPC protein

This Virus GPC protein spans the amino acid sequence from region 59-259aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP-C

UniProt

P08669

Expression Region

59-259aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CD3 delta Antibody [mFluor Violet 450 SE]
NBP2-99093MFV450 0.1 mL

Rabbit Polyclonal CD3 delta Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
MUC1 Antibody
29-576 100 µL

MUC1 Antibody

Sign In for Pricing
View Details
Diphenidol hydrochloride - Bio-X TM
BD164368 100 mg

Diphenidol hydrochloride - Bio-X TM

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster G1/S-specific cyclin-E (CycE), partial
MBS1160737 Inquire

Recombinant Drosophila melanogaster G1/S-specific cyclin-E (CycE), partial

Sign In for Pricing
View Details
Anti-NOS2 antibody
STJ94535 200 µl

Anti-NOS2 antibody

Sign In for Pricing
View Details
BDKRB1 Antibody - C-terminal region : HRP (ARP65156_P050-HRP)
ARP65156_P050-HRP 100 µL

BDKRB1 Antibody - C-terminal region : HRP (ARP65156_P050-HRP)

Sign In for Pricing
View Details