Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus GPC protein

This Virus GPC protein spans the amino acid sequence from region 59-259aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP-C

UniProt

P08669

Expression Region

59-259aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Prolactin Recombinant Rabbit Monoclonal Antibody [PSH03-14] - BSA and Azide free (Detector)
HA721942 100 µL

Human Prolactin Recombinant Rabbit Monoclonal Antibody [PSH03-14] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
PNMA2, Recombinant, Human, aa2-261, His-Tag (Paraneoplastic Antigen Ma2)
374773-01 20 µg

PNMA2, Recombinant, Human, aa2-261, His-Tag (Paraneoplastic Antigen Ma2)

Sign In for Pricing
View Details
PNMA2, Recombinant, Human, aa2-261, His-Tag (Paraneoplastic Antigen Ma2)
374773-02 100 µg

PNMA2, Recombinant, Human, aa2-261, His-Tag (Paraneoplastic Antigen Ma2)

Sign In for Pricing
View Details
α2B-AR shRNA (m) Lentiviral Particles
sc-39865-V 200 µL

α2B-AR shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Evolocumab (anti-PCSK9)
C00042-01 1 mg

Evolocumab (anti-PCSK9)

Sign In for Pricing
View Details
Evolocumab (anti-PCSK9)
C00042-02 5x 1 mg

Evolocumab (anti-PCSK9)

Sign In for Pricing
View Details