Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria ctfB protein

This Bacteria ctfB protein spans the amino acid sequence from region 1-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acetoacetyl-CoA, acetate/butyrate CoA-transferase subunit B (Coat B)

UniProt

P23673

Expression Region

1-221aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MINDKNLAKEIIAKRVARELKNGQLVNLGVGLPTMVADYIPKNFKITFQSENGIVGMGASPKINEADKDVVNAGGDYTTVLPDGTFFDSSVSFSLIRGGHVDVTVLGALQVDEKGNIANWIVPGKMLSGMGGAMDLVNGAKKVIIAMRHTNKGQPKILKKCTLPLTAKSQANLIVTELGVIEVINDGLLLTEINKNTTIDEIRSLTAADLLISNELRPMAV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM209 Protein Vector (Mouse) (pPM-C-HA)
46995024 500 ng

TMEM209 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Egl nine homolog 2polyclonal
314510-01 50 µg

Egl nine homolog 2polyclonal

Sign In for Pricing
View Details
Egl nine homolog 2polyclonal
314510-02 100 µg

Egl nine homolog 2polyclonal

Sign In for Pricing
View Details
DeoD Antibody
orb812898 2 mg

DeoD Antibody

Sign In for Pricing
View Details
Human Vitamin C, VC ELISA Kit
CELI-66062h 96 Tests

Human Vitamin C, VC ELISA Kit

Sign In for Pricing
View Details
C1orf98 AAV siRNA Pooled Vector
14239161 1.0 µg

C1orf98 AAV siRNA Pooled Vector

Sign In for Pricing
View Details