Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SYNGAP1 protein

This Human SYNGAP1 protein spans the amino acid sequence from region 1161-1343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal RasGAP (Synaptic Ras GTPase-activating protein 1) (Synaptic Ras-GAP 1) (KIAA1938)

UniProt

Q96PV0

Expression Region

1161-1343aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAM50A shRNA (UAS) - Lentiviral human FAM50A shRNA (UAS, GFP) (100)
GTR15105945 1 Vial

Lentiviral human FAM50A shRNA (UAS) - Lentiviral human FAM50A shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rcan1 Rabbit Polyclonal Antibody (FITC)
orb2142788 100 µL

Rcan1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Cytokeratin 14 polyclonal antibody
BS60854 50ul

Cytokeratin 14 polyclonal antibody

Sign In for Pricing
View Details
Anti-Rsk 2/MAPKAP Kinase 1b/RPS6KA3 Picoband® Antibody Fluoro647 Conjugated
A02215-2-Fluoro647 100 µg/Vial

Anti-Rsk 2/MAPKAP Kinase 1b/RPS6KA3 Picoband® Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
RAPGEF5 (GFR, KIAA0277, MRGEF, Rap Guanine Nucleotide Exchange Factor 5, Guanine Nucleotide Exchange Factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (MaxLight 550)
132313-ML550 100 µL

RAPGEF5 (GFR, KIAA0277, MRGEF, Rap Guanine Nucleotide Exchange Factor 5, Guanine Nucleotide Exchange Factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (MaxLight 550)

Sign In for Pricing
View Details
Compound NP-013699
T129853-01 10 mg

Compound NP-013699

Sign In for Pricing
View Details