Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBL2 protein

This Human RBL2 protein spans the amino acid sequence from region 417-616aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

130 kDa retinoblastoma-associated protein (p130) (Retinoblastoma-related protein 2) (RBR-2) (pRb2) (RB2)

UniProt

Q08999

Expression Region

417-616aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 1700018F24Rik shRNA (UAS) - Lentiviral mouse 1700018F24Rik shRNA (UAS) plasmid
GTR15160195 1 Vial

Lentiviral mouse 1700018F24Rik shRNA (UAS) - Lentiviral mouse 1700018F24Rik shRNA (UAS) plasmid

Sign In for Pricing
View Details
DYNC1I1 Rabbit Polyclonal Antibody (HRP)
orb2109914 100 µL

DYNC1I1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human SRSF6 Pre-designed siRNA Set B
SI015806B 1 Each

Human SRSF6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ATP5D (ATP Synthase Subunit delta, Mitochondrial, F-ATPase delta Subunit) (FITC)
029054 100 µg

ATP5D (ATP Synthase Subunit delta, Mitochondrial, F-ATPase delta Subunit) (FITC)

Sign In for Pricing
View Details
Angelol D
orb1992452-01 1 mg

Angelol D

Sign In for Pricing
View Details
Angelol D
orb1992452-02 2 mg

Angelol D

Sign In for Pricing
View Details