Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CAMK2N1 protein

This Human CAMK2N1 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CaMKII inhibitory protein alpha (CaMKIIN-alpha)

UniProt

Q7Z7J9

Expression Region

1-78aa

Tag

N-terminal 6xHis-Trx-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caprisil C18-X HPLC Column, 3 µm, 100 Å, CE535-C18-X x 250 mm
CE535-C18-X 3 µm

Caprisil C18-X HPLC Column, 3 µm, 100 Å, CE535-C18-X x 250 mm

Sign In for Pricing
View Details
FAM174A Rabbit Polyclonal Antibody
orb3070126-01 30 µL

FAM174A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM174A Rabbit Polyclonal Antibody
orb3070126-02 50 µL

FAM174A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM174A Rabbit Polyclonal Antibody
orb3070126-03 100 µL

FAM174A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM174A Rabbit Polyclonal Antibody
orb3070126-04 200 µL

FAM174A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 (Mono-Methyl-Lys79) Monoclonal Antibody
orb311612-01 50 μL

Histone H3 (Mono-Methyl-Lys79) Monoclonal Antibody

Sign In for Pricing
View Details