Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria grxD protein

This Bacteria grxD protein spans the amino acid sequence from region 1-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Monothiol glutaredoxin (ydhD) (Grx4)

UniProt

P0AC72

Expression Region

1-115aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)
MBS2037028-01 0.1 mL

HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)
MBS2037028-02 0.2 mL

HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)
MBS2037028-03 0.5 mL

HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)
MBS2037028-04 1 mL

HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)
MBS2037028-05 5 mL

HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)
MBS2037028-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Interleukin 5 (IL5)

Sign In for Pricing
View Details