Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant patA protein

This Plant patA protein spans the amino acid sequence from region 1-379aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PAT-1

UniProt

P39048

Expression Region

1-379aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

Field of Research

Developmental Biology, Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKTLPITRYRFFQKIQPLSLLKKITGKTITGCLQVFSTSGTWSIYVEEGKLIYACYSERMFEPLYRHLGNLSPQIATLPKEINEQLRAIFETGIENQAIPNPDYLAICWLVNQKYISSSQAAVLIEQLALEVVESFLMLEEGSYEFIPESFLDDLPKFCYLNVRLLVEQCQQHGRVPEAFRREASSQEISSSTEHNQIPVNNRRSTKFTSPPHTQPKPEPRLPQINTNKSTEYSKRYASQPNTVNHGYSQTSATSTDKKIYTIFCIDENPIVLNNIKNFLDDQIFAVIGVTDSLKALMEILCTKPDIILINVDMPDLDGYELCSLLRKHSYFKNTPVIMVTEKAGLVDRARAKIVRASGHLTKPFNQGDLLKVIFKHIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-KL-shRNA1-mCherry-Neo Plasmid
PVT70441 2 µg

PLV3-U6-KL-shRNA1-mCherry-Neo Plasmid

Sign In for Pricing
View Details
ABL2 Rabbit Polyclonal Antibody (PE-Cy5)
orb902128 100 µL

ABL2 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
B9D1 Rabbit pAb
E45R27860N-50 50 µL

B9D1 Rabbit pAb

Sign In for Pricing
View Details
Mouse Neurotrophin 4 (NT-4) ELISA Kit
201-02-0086 96 Tests

Mouse Neurotrophin 4 (NT-4) ELISA Kit

Sign In for Pricing
View Details
Cobra venom factor Antibody (HRP)
abx319378-01 20 µg

Cobra venom factor Antibody (HRP)

Sign In for Pricing
View Details
Cobra venom factor Antibody (HRP)
abx319378-02 50 µg

Cobra venom factor Antibody (HRP)

Sign In for Pricing
View Details