Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KSR1 protein

This Human KSR1 protein spans the amino acid sequence from region 404-598aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KSR

UniProt

Q8IVT5

Expression Region

404-598aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GNT5 Antibody (Center)
E45R32721G-1 100 µL

B3GNT5 Antibody (Center)

Sign In for Pricing
View Details
Topoisomerase 2 alpha Mouse Monoclonal Antibody
orb705505-01 30 µL

Topoisomerase 2 alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Topoisomerase 2 alpha Mouse Monoclonal Antibody
orb705505-02 50 μL

Topoisomerase 2 alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Topoisomerase 2 alpha Mouse Monoclonal Antibody
orb705505-03 100 µL

Topoisomerase 2 alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Topoisomerase 2 alpha Mouse Monoclonal Antibody
orb705505-04 200 µL

Topoisomerase 2 alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rhodizonic acid sodium salt
GT1736-5g 5 g

Rhodizonic acid sodium salt

Sign In for Pricing
View Details