Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine FDX1 protein

This Bovine FDX1 protein spans the amino acid sequence from region 59-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

UniProt

P00257

Expression Region

59-186aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PAIP2 activation kit by CRISPRa
GA109673 1 Kit

Human PAIP2 activation kit by CRISPRa

Sign In for Pricing
View Details
C-Reactive Protein (CRP) Human ELISA Kit
K069-H1 1 Plate

C-Reactive Protein (CRP) Human ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560682 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Human MARCH I (MARCH1) activation kit by CRISPRa
GA110455 1 Kit

Human MARCH I (MARCH1) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse IL-12 p40 Antibody Pair Set
E-KAB-0580 50 µL & 100 µg

Mouse IL-12 p40 Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Blocks, Endometrium
CB617332 1 Block

Frozen Tissue Blocks, Endometrium

Sign In for Pricing
View Details