Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine FDX1 protein

This Bovine FDX1 protein spans the amino acid sequence from region 59-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

UniProt

P00257

Expression Region

59-186aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), CF594 conjugate, 0.1mg/mL
BNC942476-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2476), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS517633 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
LMBRD1 (NM_018368) Human Recombinant Protein
TP307958 20 µg

LMBRD1 (NM_018368) Human Recombinant Protein

Sign In for Pricing
View Details
Pcsk9 Mouse Gene Knockout Kit (CRISPR)
KN312980BN 1 Kit

Pcsk9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human HVEM/TNFRSF14, C-Flag Tag
HA210556-01 20 µg

Human HVEM/TNFRSF14, C-Flag Tag

Sign In for Pricing
View Details
Human HVEM/TNFRSF14, C-Flag Tag
HA210556-02 50 µg

Human HVEM/TNFRSF14, C-Flag Tag

Sign In for Pricing
View Details