Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF1 protein

This Human FGF1 protein spans the amino acid sequence from region 16-155aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Acidic fibroblast growth factor (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin-binding growth factor 1) (HBGF-1) (FGF-1) (FGFA)

UniProt

P05230

Expression Region

16-155aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDGA2 Antibody Fluoro594 Conjugated
orb3165920 100 µg

MDGA2 Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details
Selenoprotein W shRNA Plasmid (m)
sc-40933-SH 20 µg

Selenoprotein W shRNA Plasmid (m)

Sign In for Pricing
View Details
Cytochrome B245 Light Chain Antibody
GWB-82309D 0.1 mg

Cytochrome B245 Light Chain Antibody

Sign In for Pricing
View Details
ZNF707 polyclonal antibody
orb648226-01 50 μL

ZNF707 polyclonal antibody

Sign In for Pricing
View Details
ZNF707 polyclonal antibody
orb648226-02 100 µL

ZNF707 polyclonal antibody

Sign In for Pricing
View Details
ZNF707 polyclonal antibody
orb648226-03 200 µL

ZNF707 polyclonal antibody

Sign In for Pricing
View Details