Bacteria Paracoccus denitrificans Electron transfer flavoprotein-ubiquinone oxidoreductase protein
This Bacteria Paracoccus denitrificans Electron transfer flavoprotein-ubiquinone oxidoreductase protein spans the amino acid sequence from region 1-31aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Electron-transferring-flavoprotein dehydrogenase (ETF dehydrogenase) (ETF-QO) (ETF-ubiquinone oxidoreductase)
UniProt
P55932
Expression Region
1-31aa
Tag
N-terminal 6xHis-KSI-tagged
Source
E.coli
Origin
Paracoccus denitrificans
Field of Research
Non-Animal
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SDIGGSMDYDVVIVGAGGAGLSAAILKQVNP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401081-100 1x 100 µL
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742659-500 1x 500 µL
Cytokeratin 13 (Non-Keratinized Squamous Epithelial Marker) (KRT13/2213), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details