Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria KMP-11 protein

This Bacteria KMP-11 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KMP11

UniProt

Q9U6Z1

Expression Region

1-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Trypanosoma cruzi

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pokemon (ZBTB7A) (NM_015898) Human Over-expression Lysate
LS051341 100 µg

Pokemon (ZBTB7A) (NM_015898) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant human ULBP-1 protein
ATGP1731-100 100 µg

Recombinant human ULBP-1 protein

Sign In for Pricing
View Details
BTRC Antibody, FITC conjugated
MBS7051682-01 0.05 mg

BTRC Antibody, FITC conjugated

Sign In for Pricing
View Details
BTRC Antibody, FITC conjugated
MBS7051682-02 0.1 mg

BTRC Antibody, FITC conjugated

Sign In for Pricing
View Details
BTRC Antibody, FITC conjugated
MBS7051682-03 5x 0.1 mg

BTRC Antibody, FITC conjugated

Sign In for Pricing
View Details
SPATA5 Rabbit Polyclonal Antibody
TA381918 100 µL

SPATA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details