Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria KMP-11 protein

This Bacteria KMP-11 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KMP11

UniProt

Q9U6Z1

Expression Region

1-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Trypanosoma cruzi

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.X antibody (Ser139)
70R-37327 100 ug

Histone H2A.X antibody (Ser139)

Sign In for Pricing
View Details
OLIG1 antibody
orb73888 100 µL

OLIG1 antibody

Sign In for Pricing
View Details
Ribosome-inactivating protein bryodin I Antibody; Biotin conjugated
MBS7005034-01 0.05 mg

Ribosome-inactivating protein bryodin I Antibody; Biotin conjugated

Sign In for Pricing
View Details
Ribosome-inactivating protein bryodin I Antibody; Biotin conjugated
MBS7005034-02 0.1 mg

Ribosome-inactivating protein bryodin I Antibody; Biotin conjugated

Sign In for Pricing
View Details
Ribosome-inactivating protein bryodin I Antibody; Biotin conjugated
MBS7005034-03 5x 0.1 mg

Ribosome-inactivating protein bryodin I Antibody; Biotin conjugated

Sign In for Pricing
View Details
RAB27B Polyclonal Antibody, FITC Conjugated
A50438-100 100 µL

RAB27B Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details