Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria KMP-11 protein

This Bacteria KMP-11 protein spans the amino acid sequence from region 1-92aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

KMP11

UniProt

Q9U6Z1

Expression Region

1-92aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Trypanosoma cruzi

Field of Research

Microbiology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Coagulation Factor IX ELISA Kit
MBS017072 Inquire

Rabbit Coagulation Factor IX ELISA Kit

Sign In for Pricing
View Details
Human Catenin beta-1 ELISA Kit
MBS9426402-01 96 Tests

Human Catenin beta-1 ELISA Kit

Sign In for Pricing
View Details
Human Catenin beta-1 ELISA Kit
MBS9426402-02 5x 96 Tests

Human Catenin beta-1 ELISA Kit

Sign In for Pricing
View Details
Mouse Nfatc3 ELISA KIT
ELI-13824m 96 Tests

Mouse Nfatc3 ELISA KIT

Sign In for Pricing
View Details
BBC3 Blocking Peptide
33R-9339 0.1 mg

BBC3 Blocking Peptide

Sign In for Pricing
View Details
Plasmid DNA Midi Endotoxin Removal kit (25 prep)-spin column
FAPDE-005B-025 25 Preparations

Plasmid DNA Midi Endotoxin Removal kit (25 prep)-spin column

Sign In for Pricing
View Details