Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GM2A protein

This Human GM2A protein spans the amino acid sequence from region 32-193aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cerebroside sulfate activator protein (GM2-AP) (Sphingolipid activator protein 3)

UniProt

P17900

Expression Region

32-193aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CSNK2A1/CK2A1 Protein (GST Tag)
PKSH030405 50 µg

Recombinant Human CSNK2A1/CK2A1 Protein (GST Tag)

Sign In for Pricing
View Details
OR2G2 Antibody
8G547-AAT 50 µg

OR2G2 Antibody

Sign In for Pricing
View Details
Weighing Scale BBAL-406
BBAL-406 1 Unit

Weighing Scale BBAL-406

Sign In for Pricing
View Details
ATG4B Antibody: FITC
SPC-630D-FITC 100 µg

ATG4B Antibody: FITC

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF594 conjugate, 0.1mg/mL
BNC941481-500 1x 500 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purified Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017A-01 25 µg

Purified Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details