Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria nifH1 protein

This Bacteria nifH1 protein spans the amino acid sequence from region 1-275aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nitrogenase Fe protein 1 (Nitrogenase component II) (Nitrogenase reductase)

UniProt

P51602

Expression Region

1-275aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Methanobacterium ivanovii

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVRKIAIYGKGGIGKSTTTQNTASAMAHFHNQRVMIHGCDPKADSTRMILGGKMQTTMMDTLREEGEEACMDLDNVMSTGFKDIKCVESGGPEPGVGCAGRGVITAITIMEHMKVYDDNDFVFFDVLGDVVCGGFAMPIRDGKAEEIYIVASGEMMALYAANNLCKGMVKYAEQSGVRLGGIICNSRNVDGEKELLEEFCKRIGTQMIHFVPRDNIVQKAEFNKRTVVDFDAECSQAHEYSELARKIIENDNFVIPDPMTMDELEEMVVSYGLMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-RAP shRNA Plasmid (m)
sc-149773-SH 20 µg

N-RAP shRNA Plasmid (m)

Sign In for Pricing
View Details
Trpt1 Antibody
orb861686 2 mg

Trpt1 Antibody

Sign In for Pricing
View Details
Purified Rat IgG2b, kappa Isotype Control
MBS4514331-01 0.025 mg

Purified Rat IgG2b, kappa Isotype Control

Sign In for Pricing
View Details
Purified Rat IgG2b, kappa Isotype Control
MBS4514331-02 0.05 mg

Purified Rat IgG2b, kappa Isotype Control

Sign In for Pricing
View Details
Purified Rat IgG2b, kappa Isotype Control
MBS4514331-03 0.1 mg

Purified Rat IgG2b, kappa Isotype Control

Sign In for Pricing
View Details
Purified Rat IgG2b, kappa Isotype Control
MBS4514331-04 0.2 mg

Purified Rat IgG2b, kappa Isotype Control

Sign In for Pricing
View Details