Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria nifH1 protein

This Bacteria nifH1 protein spans the amino acid sequence from region 1-275aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nitrogenase Fe protein 1 (Nitrogenase component II) (Nitrogenase reductase)

UniProt

P51602

Expression Region

1-275aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Methanobacterium ivanovii

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVRKIAIYGKGGIGKSTTTQNTASAMAHFHNQRVMIHGCDPKADSTRMILGGKMQTTMMDTLREEGEEACMDLDNVMSTGFKDIKCVESGGPEPGVGCAGRGVITAITIMEHMKVYDDNDFVFFDVLGDVVCGGFAMPIRDGKAEEIYIVASGEMMALYAANNLCKGMVKYAEQSGVRLGGIICNSRNVDGEKELLEEFCKRIGTQMIHFVPRDNIVQKAEFNKRTVVDFDAECSQAHEYSELARKIIENDNFVIPDPMTMDELEEMVVSYGLMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF647 conjugate, 0.1mg/mL
BNC471192-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (HSP90B1/1192), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fenbendazole Sulfoxide-d3
TRC-F246792-25MG 25 mg

Fenbendazole Sulfoxide-d3

Sign In for Pricing
View Details
CD74 (LN-2 + CLIP/813), CF740 conjugate, 0.1mg/mL
BNC741207-100 1x 100 µL

CD74 (LN-2 + CLIP/813), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), CF740 conjugate, 0.1mg/mL
BNC742004-100 1x 100 µL

CD134, Mouse (OX40) (OX-86), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Beta-D-Ribofuranosyl-4-thiazolecarboxylic Acid Ethyl Ester
TRC-R415730-10MG 10 mg

2-Beta-D-Ribofuranosyl-4-thiazolecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
L-Lysine-2,3,3,4,4,5,5,6,6-d9 Hydrochloride
TRC-L468908-25MG 25 mg

L-Lysine-2,3,3,4,4,5,5,6,6-d9 Hydrochloride

Sign In for Pricing
View Details