Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDCD1LG2 protein

This Human PDCD1LG2 protein spans the amino acid sequence from region 21-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Butyrophilin B7-DC (B7-DC) (CD_antigen, CD273) (B7DC) (CD273) (PDCD1L2) (PDL2)

UniProt

Q9BQ51

Expression Region

21-118aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RV01
BA7150-1 1 mg

RV01

Sign In for Pricing
View Details
ACTC1 Protein Vector (Mouse) (pPB-N-His)
PV152051 500 ng

ACTC1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)
MBS1049101-01 0.02 mg (E-Coli)

Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)
MBS1049101-02 0.1 mg (E-Coli)

Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)
MBS1049101-03 0.02 mg (Yeast)

Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)

Sign In for Pricing
View Details
Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)
MBS1049101-04 0.1 mg (Yeast)

Recombinant Acinetobacter baumannii NADH-quinone oxidoreductase subunit I (nuoI)

Sign In for Pricing
View Details