Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

Recombinant Human Valacyclovir hydrolase (BPHL)

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-17-3p mimic
HY-R02695-01 5 nmol

Mmu-miR-17-3p mimic

Sign In for Pricing
View Details
Mmu-miR-17-3p mimic
HY-R02695-02 20 nmol

Mmu-miR-17-3p mimic

Sign In for Pricing
View Details
PPM1M Protein Lysate (Human) with C-Ha Tag
37389031 100 µg

PPM1M Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid
SEA91956-01 0.5 g

2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid

Sign In for Pricing
View Details
2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid
SEA91956-02 5 g

2-[ (Methoxycarbonyl) amino]-4-methylpentanoic acid

Sign In for Pricing
View Details
Human CGA&TSHB protein, No tag&His tag
S0A8010-01 10 µg

Human CGA&TSHB protein, No tag&His tag

Sign In for Pricing
View Details