Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

Recombinant Human Valacyclovir hydrolase (BPHL)

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM64 CRISPR Knock Out 293T Cell Line (Human)
47832141 1x 10^6 Cells / 1.0 mL

TRIM64 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ELISA Kit For Annexin A11
E11276m 96 Tests

ELISA Kit For Annexin A11

Sign In for Pricing
View Details
Human OBG-Like ATPase 1 (OLA1) Protein
abx659840-01 10 µg

Human OBG-Like ATPase 1 (OLA1) Protein

Sign In for Pricing
View Details
Human OBG-Like ATPase 1 (OLA1) Protein
abx659840-02 50 µg

Human OBG-Like ATPase 1 (OLA1) Protein

Sign In for Pricing
View Details
Human OBG-Like ATPase 1 (OLA1) Protein
abx659840-03 100 µg

Human OBG-Like ATPase 1 (OLA1) Protein

Sign In for Pricing
View Details
Human OBG-Like ATPase 1 (OLA1) Protein
abx659840-04 200 µg

Human OBG-Like ATPase 1 (OLA1) Protein

Sign In for Pricing
View Details