Reptile Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin protein
This Reptile Agkistrodon contortrix contortrix Thrombin-like enzyme contortrixobin protein spans the amino acid sequence from region 1-234aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Fibrinogen-clotting enzyme (Snake venom serine protease) (SVSP) (Venombin B)
UniProt
P82981
Expression Region
1-234aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Agkistrodon contortrix contortrix (Southern copperhead)
Field of Research
Protein Biochemistry
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VVGGDECNINEHRFLVAIFNSNGFVCSGTLINQEWVLTAAHCDSTDFQIKLGAHSKKVLNEDEQIRNPKEKFICPNKKNDEVLDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCHIMGWGSITPIEVTFPDVPHCAYINLLDDAACQPGYPEVLPEYRTLCAGILEGGKDTCNYDSGGPLICNGQFQGIVSYGAHPCGQSLKPGIYTKVFDYNDWIQSIIAGNTAATCPP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880008-100 1x 100 µL
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471948-100 1x 100 µL
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details