Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF1B protein

This Human TNFRSF1B protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor 2 , TNF-R2Tumor necrosis factor receptor type II , TNF-RII , TNFR-IIp75p80 TNF-alpha receptor, CD120bINN, Etanercept

UniProt

P20333

Expression Region

23-257aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kinamycin C
HY-125058 1 Each

Kinamycin C

Sign In for Pricing
View Details
Sulpiride Impurity 4
RM-S161830-01 10 mg

Sulpiride Impurity 4

Sign In for Pricing
View Details
Sulpiride Impurity 4
RM-S161830-02 25 mg

Sulpiride Impurity 4

Sign In for Pricing
View Details
Sulpiride Impurity 4
RM-S161830-03 50 mg

Sulpiride Impurity 4

Sign In for Pricing
View Details
Sulpiride Impurity 4
RM-S161830-04 100 mg

Sulpiride Impurity 4

Sign In for Pricing
View Details
JMJD1B Rabbit Polyclonal Antibody (BF750)
orb2426962 100 µL

JMJD1B Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details