Mouse Cnrip1 protein
This Mouse Cnrip1 protein spans the amino acid sequence from region 1-464aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cnrip1CB1 cannabinoid receptor-interacting protein 1, CRIP-1
UniProt
Q5M8N0
Expression Region
1-464aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Yeast
Origin
Mus musculus (Mouse)
Field of Research
Neuroscience
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1482098-01 0.02 mg (E-Coli)
Recombinant Pseudomonas entomophila Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1482098-02 0.1 mg (E-Coli)
Recombinant Pseudomonas entomophila Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1482098-03 0.02 mg (Yeast)
Recombinant Pseudomonas entomophila Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1482098-04 0.1 mg (Yeast)
Recombinant Pseudomonas entomophila Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1482098-05 0.02 mg (Baculovirus)
Recombinant Pseudomonas entomophila Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details MBS1482098-06 1 mg (E-Coli)
Recombinant Pseudomonas entomophila Integration host factor subunit alpha (ihfA)
Sign In for Pricing
View Details