Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine FDX1 protein

This Bovine FDX1 protein spans the amino acid sequence from region 59-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

UniProt

P00257

Expression Region

59-186aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPDC1 (NM_152422) Human Recombinant Protein
TP322339M 100 µg

PTPDC1 (NM_152422) Human Recombinant Protein

Sign In for Pricing
View Details
Ear2 (NM_007895) Mouse Tagged ORF Clone
MG201169 10 µg

Ear2 (NM_007895) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PTP epsilon (PTPRE) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]
TA501025AM 100 µL

PTP epsilon (PTPRE) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]

Sign In for Pricing
View Details
Arl4c (NM_177305) Mouse Tagged ORF Clone
MG201837 10 µg

Arl4c (NM_177305) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
KHDRBS2 (NM_152688) Human Recombinant Protein
TP305428 20 µg

KHDRBS2 (NM_152688) Human Recombinant Protein

Sign In for Pricing
View Details
RNASE9 Human Gene Knockout Kit (CRISPR)
KN420270 1 Kit

RNASE9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details