Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine FDX1 protein

This Bovine FDX1 protein spans the amino acid sequence from region 59-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

UniProt

P00257

Expression Region

59-186aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxybutenolide
TRC-H830805-25MG 25 mg

Hydroxybutenolide

Sign In for Pricing
View Details
Trimetazidine N-Carboxylic Acid Ethyl Ester
TRC-T795530-1G 1 g

Trimetazidine N-Carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
Human GEF H1 (ARHGEF2) activation kit by CRISPRa
GA106120 1 Kit

Human GEF H1 (ARHGEF2) activation kit by CRISPRa

Sign In for Pricing
View Details
Oligodendrocyte Marker Antibody Sampler Kit
HAK21061 1 Kit

Oligodendrocyte Marker Antibody Sampler Kit

Sign In for Pricing
View Details
TOP2B Antibody
KC-746-01 50 μL

TOP2B Antibody

Sign In for Pricing
View Details
TOP2B Antibody
KC-746-02 100 µL

TOP2B Antibody

Sign In for Pricing
View Details