Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine FDX1 protein

This Bovine FDX1 protein spans the amino acid sequence from region 59-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

UniProt

P00257

Expression Region

59-186aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (Autophagy Marker) (UBB/2122), Biotin conjugate, 0.1mg/mL
BNCB2122-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/2122), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR562873 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS706914 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
CD68 Mouse Monoclonal Antibody [A3C2]
EM1901-93 100 µL

CD68 Mouse Monoclonal Antibody [A3C2]

Sign In for Pricing
View Details
Mouse Ccdc39 activation kit by CRISPRa
GA205432 1 Kit

Mouse Ccdc39 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PD1 Recombinant Rabbit monoclonal Antibody
HA723522 100 µL

Human PD1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details