Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine FDX1 protein

This Bovine FDX1 protein spans the amino acid sequence from region 59-186aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adrenal ferredoxin (Ferredoxin-1) (Hepato-ferredoxin) (ADX)

UniProt

P00257

Expression Region

59-186aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSEDKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARESIDMGMNSSKIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl Isopropyl Ether
TRC-B692450-500MG 500 mg

tert-Butyl Isopropyl Ether

Sign In for Pricing
View Details
Mouse Epb41l4b activation kit by CRISPRa
GA205679 1 Kit

Mouse Epb41l4b activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB503943 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS711271 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
KCNJ9 Rabbit Polyclonal Antibody
AP01403PU-N 100 µg

KCNJ9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Golga7 (NM_001042484) Mouse Tagged ORF Clone
MG200847 10 µg

Golga7 (NM_001042484) Mouse Tagged ORF Clone

Sign In for Pricing
View Details