Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Defb33 protein

This Mouse Defb33 protein spans the amino acid sequence from region 21-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Defensin, beta 33

UniProt

Q30KN3

Expression Region

21-62aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKRNSKFRPCEKMGGICKSQKTHGCSILPAECKSRYKHCCRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Beta-defensin 128 (DEFB128) ELISA
KBH6550 96 Well

GENLISA™ Human Beta-defensin 128 (DEFB128) ELISA

Sign In for Pricing
View Details
Alpha 2 antiplasmin Rabbit Polyclonal Antibody (BF594)
orb2402654 100 µL

Alpha 2 antiplasmin Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350
MBS4517027-01 0.1 mL

Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350

Sign In for Pricing
View Details
Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350
MBS4517027-02 0.5 mL

Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350

Sign In for Pricing
View Details
Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350
MBS4517027-03 1 mL

Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350

Sign In for Pricing
View Details
Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350
MBS4517027-04 5x 1 mL

Rabbit Anti-Cat IgG (H&L) - Alexa Fluor 350

Sign In for Pricing
View Details