Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GRIN2B protein

This Human GRIN2B protein spans the amino acid sequence from region 2-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC, 2.7.13.3) ) (nm23-H2) (NM23B)

UniProt

P22392

Expression Region

2-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX43 sgRNA CRISPR Lentivector (Human) (Target 1)
K0574102 1.0 µg DNA

DDX43 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MLLT11 Polyclonal Antibody, Cy7 Conjugated
bs-8562R-Cy7-TR 20 µL

MLLT11 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
ZDHHC8 (Zinc Finger DHHC Domain-containing Protein 8, DHHC-8, Probable Palmitoyltransferase ZDHHC8, KIAA1292, Zinc Finger Protein 378, ZNF378, ZDHHCL1) (MaxLight 405)
MBS6193472-01 0.1 mL

ZDHHC8 (Zinc Finger DHHC Domain-containing Protein 8, DHHC-8, Probable Palmitoyltransferase ZDHHC8, KIAA1292, Zinc Finger Protein 378, ZNF378, ZDHHCL1) (MaxLight 405)

Sign In for Pricing
View Details
ZDHHC8 (Zinc Finger DHHC Domain-containing Protein 8, DHHC-8, Probable Palmitoyltransferase ZDHHC8, KIAA1292, Zinc Finger Protein 378, ZNF378, ZDHHCL1) (MaxLight 405)
MBS6193472-02 5x 0.1 mL

ZDHHC8 (Zinc Finger DHHC Domain-containing Protein 8, DHHC-8, Probable Palmitoyltransferase ZDHHC8, KIAA1292, Zinc Finger Protein 378, ZNF378, ZDHHCL1) (MaxLight 405)

Sign In for Pricing
View Details
CENPC1 Polyclonal Antibody
MBS9235610-01 0.1 mL

CENPC1 Polyclonal Antibody

Sign In for Pricing
View Details
CENPC1 Polyclonal Antibody
MBS9235610-02 5x 0.1 mL

CENPC1 Polyclonal Antibody

Sign In for Pricing
View Details