Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GRIN2B protein

This Human GRIN2B protein spans the amino acid sequence from region 2-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC, 2.7.13.3) ) (nm23-H2) (NM23B)

UniProt

P22392

Expression Region

2-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep receptor activator of nuclear factor-kB (RANK) ELISA Kit
OM617323 96 Strip Well

Sheep receptor activator of nuclear factor-kB (RANK) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM168 Antibody [Biotin]
NBP2-97864B 0.1 mL

Rabbit Polyclonal TMEM168 Antibody [Biotin]

Sign In for Pricing
View Details
Glyceraldehyde 3 Phosphate Dehydrogenase (GAPDH, glyceraldehyde-3-phosphate dehydrogenase, HGNC:4141, G3PD, GAPD, MGC88685) (MaxLight 490)
G8140-01L-ML490 100 µL

Glyceraldehyde 3 Phosphate Dehydrogenase (GAPDH, glyceraldehyde-3-phosphate dehydrogenase, HGNC:4141, G3PD, GAPD, MGC88685) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal NEK4 Antibody [Janelia Fluor 549]
NBP1-42686JF549 0.1 mL

Rabbit Polyclonal NEK4 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Rpl22l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6162805 3x 1.0 µg

Rpl22l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Golm1 ORF Vector (Mouse) (pORF)
ORF046381 1.0 µg DNA

Golm1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details