Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GRIN2B protein

This Human GRIN2B protein spans the amino acid sequence from region 2-152aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC, 2.7.13.3) ) (nm23-H2) (NM23B)

UniProt

P22392

Expression Region

2-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rpl7 shRNA (UAS) - Lentiviral mouse Rpl7 shRNA (UAS, RFP) (100)
GTR15141684 1 Vial

Lentiviral mouse Rpl7 shRNA (UAS) - Lentiviral mouse Rpl7 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CXorf36 (FITC)
559752-01 50 µg

CXorf36 (FITC)

Sign In for Pricing
View Details
CXorf36 (FITC)
559752-02 100 µg

CXorf36 (FITC)

Sign In for Pricing
View Details
Rabbit Monoclonal Pannexin-1 Antibody (SR1841)
NBP3-22226-50ul 50 µL

Rabbit Monoclonal Pannexin-1 Antibody (SR1841)

Sign In for Pricing
View Details
Anti-GFAP (Astrocyte & Neural Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody (Clone:ASTRO/1974R)
12-1185-20 20 µg

Anti-GFAP (Astrocyte & Neural Stem Cell Marker) Recombinant Rabbit Monoclonal Antibody (Clone:ASTRO/1974R)

Sign In for Pricing
View Details
Cd83-set siRNA/shRNA/RNAi Lentivector (Rat)
15572096 4x 500 ng

Cd83-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details