Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli yjbL protein

This E. coli yjbL protein spans the amino acid sequence from region 1-84aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YjbL, b4047, JW4007, Uncharacterized protein YjbL

UniProt

P32693

Expression Region

1-84aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NQO2 (1-231, His-tag) Human Protein
AR09422PU-N 100 µg

NQO2 (1-231, His-tag) Human Protein

Sign In for Pricing
View Details
Akr1c14 3'UTR Luciferase Stable Cell Line
TU200478 1.0 mL

Akr1c14 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Polyclonal Pou4f3 antibody - N-terminal region
APR12934G 0.05mg

Polyclonal Pou4f3 antibody - N-terminal region

Sign In for Pricing
View Details
DMRTA2 Protein Vector (Human) (pPM-C-His)
PV073560 500 ng

DMRTA2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Glycine-2-13C Ethyl Ester, Hydrochloride
sc-280752 50 mg

Glycine-2-13C Ethyl Ester, Hydrochloride

Sign In for Pricing
View Details
Mkrn1 Antibody
orb860431 2 mg

Mkrn1 Antibody

Sign In for Pricing
View Details