Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli yjbL protein

This E. coli yjbL protein spans the amino acid sequence from region 1-84aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YjbL, b4047, JW4007, Uncharacterized protein YjbL

UniProt

P32693

Expression Region

1-84aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FST
P0592-01 50 µg

Recombinant Human FST

Sign In for Pricing
View Details
Recombinant Human FST
P0592-02 200 µg

Recombinant Human FST

Sign In for Pricing
View Details
Recombinant Human FST
P0592-03 1 mg

Recombinant Human FST

Sign In for Pricing
View Details
VACWR062 Antibody, FITC conjugated
A50579-100UG 100 µg

VACWR062 Antibody, FITC conjugated

Sign In for Pricing
View Details
DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)
MBS6216615-01 0.1 mL

DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)

Sign In for Pricing
View Details
DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)
MBS6216615-02 5x 0.1 mL

DOCK4 (Dedicator of Cytokinesis 4, FLJ34238, KIAA0716, MGC134911, MGC134912) (MaxLight 550)

Sign In for Pricing
View Details