Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria inlA protein

This Bacteria inlA protein spans the amino acid sequence from region 562-770aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

InlA, LMOf2365_0471, Internalin A

UniProt

Q723K6

Expression Region

562-770aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Listeria monocytogenes serotype 4b (strain F2365)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FYN Recombinant Monoclonal Antibody [1G3]
A74489-050 50 µL

FYN Recombinant Monoclonal Antibody [1G3]

Sign In for Pricing
View Details
Cobalt (II) Chloride Hexahydrate extrapure AR, 99%
36018-01 100 g

Cobalt (II) Chloride Hexahydrate extrapure AR, 99%

Sign In for Pricing
View Details
Cobalt (II) Chloride Hexahydrate extrapure AR, 99%
36018-02 500 g

Cobalt (II) Chloride Hexahydrate extrapure AR, 99%

Sign In for Pricing
View Details
Anti-Pirin (PIR)
FY-AB51669-01 1 mL

Anti-Pirin (PIR)

Sign In for Pricing
View Details
Anti-Pirin (PIR)
FY-AB51669-02 100 µL

Anti-Pirin (PIR)

Sign In for Pricing
View Details
Anti-Pirin (PIR)
FY-AB51669-03 200 µL

Anti-Pirin (PIR)

Sign In for Pricing
View Details