Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria inlA protein

This Bacteria inlA protein spans the amino acid sequence from region 562-770aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

InlA, LMOf2365_0471, Internalin A

UniProt

Q723K6

Expression Region

562-770aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Listeria monocytogenes serotype 4b (strain F2365)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QFSINSYTATFDNDGVTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSANSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPANDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTSTMNAYDPYNSKEASLPTT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pcdhb10 shRNA (UAS) - Lentiviral mousePcdhb10 shRNA (UAS, GFP) (25)
GTR15164948 1 Vial

Lentiviral mouse Pcdhb10 shRNA (UAS) - Lentiviral mousePcdhb10 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Magnetic Plus DNA/RNA Auto Extraction kit
80-09 96 Tests

Magnetic Plus DNA/RNA Auto Extraction kit

Sign In for Pricing
View Details
EGF Human qPCR Template Standard (NM_001963)
HK202725 1 Kit

EGF Human qPCR Template Standard (NM_001963)

Sign In for Pricing
View Details
PADI2 Antibody
14-111 100 µL

PADI2 Antibody

Sign In for Pricing
View Details
DTD1/HARS2 Polyclonal Antibody
MBS9235148-01 0.1 mL

DTD1/HARS2 Polyclonal Antibody

Sign In for Pricing
View Details
DTD1/HARS2 Polyclonal Antibody
MBS9235148-02 5x 0.1 mL

DTD1/HARS2 Polyclonal Antibody

Sign In for Pricing
View Details