Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant DHN1 protein

This Plant DHN1 protein spans the amino acid sequence from region 1-139aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B8

UniProt

P12951

Expression Region

1-139aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Hordeum vulgare (Barley)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEYQGQHGHATDKVEEYGQPVAGHGGFTGGPTGTHGAAGVGGAQLQATRDGHKTDGVLRRSGSSSSSSSEDDGVGGRRKKGMKEKIKEKLPGGAHKDAAGQQQQTAMAGEYAGTHGTEATGEKKGVMDKIKEKLPGGQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Androgen Receptor (Ser578) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1603788 100 µL

Phospho-Androgen Receptor (Ser578) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Rabbit Polyclonal TMUB1 Antibody [Alexa Fluor 700]
NBP3-18424AF700 0.1 mL

Rabbit Polyclonal TMUB1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Anti-RAD21 Antibody Picoband®, Dylight594 Conjugate
A01864-2-Dylight594 100 µg

Anti-RAD21 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Isobornyl acrylate
sc-235392B 1 L

Isobornyl acrylate

Sign In for Pricing
View Details
CBR1 (Carbonyl Reductase [NADPH] 1, NADPH-dependent Carbonyl Reductase 1, Prostaglandin-E (2) 9-reductase, Prostaglandin 9-ketoreductase, 15-hydroxyprostaglandin Dehydrogenase [NADP+], CBR, CRN) (Biotin)
124392-Biotin 100 µL

CBR1 (Carbonyl Reductase [NADPH] 1, NADPH-dependent Carbonyl Reductase 1, Prostaglandin-E (2) 9-reductase, Prostaglandin 9-ketoreductase, 15-hydroxyprostaglandin Dehydrogenase [NADP+], CBR, CRN) (Biotin)

Sign In for Pricing
View Details
PAX6 Rabbit Polyclonal Antibody (BF750)
orb1580700 100 µL

PAX6 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details