Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant DHN1 protein

This Plant DHN1 protein spans the amino acid sequence from region 1-139aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B8

UniProt

P12951

Expression Region

1-139aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Hordeum vulgare (Barley)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEYQGQHGHATDKVEEYGQPVAGHGGFTGGPTGTHGAAGVGGAQLQATRDGHKTDGVLRRSGSSSSSSSEDDGVGGRRKKGMKEKIKEKLPGGAHKDAAGQQQQTAMAGEYAGTHGTEATGEKKGVMDKIKEKLPGGQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prolyl Endopeptidase (PREP) (NM_002726) Human Over-expression Lysate
LY400960 100 µg

Prolyl Endopeptidase (PREP) (NM_002726) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Mena Antibody (ENAH/1988) [Janelia Fluor 646]
NBP2-79887JF646 0.1 mL

Mouse Monoclonal Mena Antibody (ENAH/1988) [Janelia Fluor 646]

Sign In for Pricing
View Details
Recombinant Synechococcus sp. ATP synthase subunit b (atpF)
orb2930585-01 20 µg

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. ATP synthase subunit b (atpF)
orb2930585-02 100 µg

Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
STX6 Antibody
CSB-PA022902DA01HU-01 50 µg

STX6 Antibody

Sign In for Pricing
View Details
STX6 Antibody
CSB-PA022902DA01HU-02 100 µg

STX6 Antibody

Sign In for Pricing
View Details