Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm21953 (NM_001177580) Mouse Tagged ORF Clone
MR219674 10 µg

Gm21953 (NM_001177580) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human Peptide γ, Pγ ELISA Kit
YLA2586HU-01 48 Tests

Human Peptide γ, Pγ ELISA Kit

Sign In for Pricing
View Details
Human Peptide γ, Pγ ELISA Kit
YLA2586HU-02 96 Tests

Human Peptide γ, Pγ ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human XRCC5 pAb
PA14430-01 50 μL

Rabbit Anti-Human XRCC5 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human XRCC5 pAb
PA14430-02 100 μL

Rabbit Anti-Human XRCC5 pAb

Sign In for Pricing
View Details
RGD1562551 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6051002 1.0 µg DNA

RGD1562551 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details