Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ROBO2 Antibody (356001) [DyLight 594]
FAB3147M 0.1 mL

Mouse Monoclonal ROBO2 Antibody (356001) [DyLight 594]

Sign In for Pricing
View Details
TLR4 Antibody
3139-01mg 0.1 mg

TLR4 Antibody

Sign In for Pricing
View Details
10mM Tris-HCl, pH 7.6
IBS-BT081 50 mL

10mM Tris-HCl, pH 7.6

Sign In for Pricing
View Details
IKZF3, ID (IKZF3, ZNFN1A3, Zinc finger protein Aiolos, Ikaros family zinc finger protein 3) (Azide free) (HRP)
MBS6309831-01 0.2 mL

IKZF3, ID (IKZF3, ZNFN1A3, Zinc finger protein Aiolos, Ikaros family zinc finger protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
IKZF3, ID (IKZF3, ZNFN1A3, Zinc finger protein Aiolos, Ikaros family zinc finger protein 3) (Azide free) (HRP)
MBS6309831-02 5x 0.2 mL

IKZF3, ID (IKZF3, ZNFN1A3, Zinc finger protein Aiolos, Ikaros family zinc finger protein 3) (Azide free) (HRP)

Sign In for Pricing
View Details
Bromo-PEG7-Boc
HY-134677 100 mg

Bromo-PEG7-Boc

Sign In for Pricing
View Details