Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BPHL protein

This Human BPHL protein spans the amino acid sequence from region 38-291aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp) (Breast epithelial mucin-associated antigen) (MCNAA)

UniProt

Q86WA6

Expression Region

38-291aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGK (Serum/Glucocorticoid Regulated Kinase 1, SGK) (MaxLight 550)
251589-ML550 100 µL

SGK (Serum/Glucocorticoid Regulated Kinase 1, SGK) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Human DBP/GC Protein, N-His
orb3062840-01 50 µg

Recombinant Human DBP/GC Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DBP/GC Protein, N-His
orb3062840-02 100 µg

Recombinant Human DBP/GC Protein, N-His

Sign In for Pricing
View Details
Recombinant Human DBP/GC Protein, N-His
orb3062840-03 1 mg

Recombinant Human DBP/GC Protein, N-His

Sign In for Pricing
View Details
(1S,2S)-(+)-1,2-Diaminocyclohexane
RM9421-1G 1 unit

(1S,2S)-(+)-1,2-Diaminocyclohexane

Sign In for Pricing
View Details
Cdh5 Mouse Pre-designed siRNA Set A
HY-RS18127 1 Set

Cdh5 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details