Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Npy2r protein

This Mouse Npy2r protein spans the amino acid sequence from region 1-51aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NPY-Y2 receptor (Y2 receptor)

UniProt

P97295

Expression Region

1-51aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAND5 3'UTR GFP Stable Cell Line
TU055549 1.0 mL

DAND5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HSP-70 Cofactor (HSP24) E.Coli Recombinant (GrpE E.Coli)
PT_40772-01 5 µg

HSP-70 Cofactor (HSP24) E.Coli Recombinant (GrpE E.Coli)

Sign In for Pricing
View Details
HSP-70 Cofactor (HSP24) E.Coli Recombinant (GrpE E.Coli)
PT_40772-02 25 µg

HSP-70 Cofactor (HSP24) E.Coli Recombinant (GrpE E.Coli)

Sign In for Pricing
View Details
HSP-70 Cofactor (HSP24) E.Coli Recombinant (GrpE E.Coli)
PT_40772-03 1 mg

HSP-70 Cofactor (HSP24) E.Coli Recombinant (GrpE E.Coli)

Sign In for Pricing
View Details
Active Interleukin 11 (IL11)
TRV-0001268-01 10 µg

Active Interleukin 11 (IL11)

Sign In for Pricing
View Details
Active Interleukin 11 (IL11)
TRV-0001268-02 50 µg

Active Interleukin 11 (IL11)

Sign In for Pricing
View Details