Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hadha protein

This Mouse Hadha protein spans the amino acid sequence from region 348-763aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TP-alpha

UniProt

Q8BMS1

Expression Region

348-763aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LCKKNKFGAPQKNVQQLAILGAGLMGAGIAQVSVDKGLKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMVIEAVFEDLGVKHKVLKEVESVTPEHCIFASNTSALPINQIAAVSKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAVGLRQGKVIIVVKDGPGFYTTRCLAPMMSEVMRILQEGVDPKKLDALTTGFGFPVGAATLADEVGVDVAQHVAEDLGKAFGERFGGGSVELLKQMVSKGFLGRKSGKGFYIYQEGSKNKSLNSEMDNILANLRLPAKPEVSSDEDVQYRVITRFVNEAVLCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQFTPCQLLLDHANNSSKKFYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sox17 (Transcription Factor SOX-17, Sox17, Sox-17) (AP)
MBS6459385-01 0.2 mL

Sox17 (Transcription Factor SOX-17, Sox17, Sox-17) (AP)

Sign In for Pricing
View Details
Sox17 (Transcription Factor SOX-17, Sox17, Sox-17) (AP)
MBS6459385-02 5x 0.2 mL

Sox17 (Transcription Factor SOX-17, Sox17, Sox-17) (AP)

Sign In for Pricing
View Details
Glutathione S-Transferase mu, Control Peptide (GSTmu)
G8135-20J 100 µL

Glutathione S-Transferase mu, Control Peptide (GSTmu)

Sign In for Pricing
View Details
Catenin-gamma Polyclonal Antibody
MBS9242953-01 0.1 mL

Catenin-gamma Polyclonal Antibody

Sign In for Pricing
View Details
Catenin-gamma Polyclonal Antibody
MBS9242953-02 5x 0.1 mL

Catenin-gamma Polyclonal Antibody

Sign In for Pricing
View Details
Glechoma hederacea (GHA) (Texas Red)
G2035-35L 1 mg

Glechoma hederacea (GHA) (Texas Red)

Sign In for Pricing
View Details