Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus SSA1 protein

This Virus SSA1 protein spans the amino acid sequence from region 443-642aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heat shock protein YG100

UniProt

P10591

Expression Region

443-642aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR8-AS1 ORF Vector (Human) (pORF)
ORF033955 1.0 µg DNA

TLR8-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-TNFSF13 Polyclonal Antibody
TMAB-13639-01 50 μL

Anti-TNFSF13 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TNFSF13 Polyclonal Antibody
TMAB-13639-02 100 µL

Anti-TNFSF13 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TNFSF13 Polyclonal Antibody
TMAB-13639-03 200 µL

Anti-TNFSF13 Polyclonal Antibody

Sign In for Pricing
View Details
TBC1D3P4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV786783 1.0 µg DNA

TBC1D3P4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PROCA1 ORF Vector (Human) (pORF)
ORF008231 1.0 µg DNA

PROCA1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details