Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus SSA1 protein

This Virus SSA1 protein spans the amino acid sequence from region 443-642aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heat shock protein YG100

UniProt

P10591

Expression Region

443-642aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP5F Protein Vector (Mouse) (pPM-C-His)
PV191885 500 ng

INPP5F Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti-NSMCE2 Antibody Picoband®, Dylight550 Conjugate
A06693-1-Dylight550 100 µg

Anti-NSMCE2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Lentiviral human OLFM3 sgRNA gene knockout kit - Lentiviral human OLFM3 sgRNA gene knockout kit (plasmid)
GTR15366335 1 Vial

Lentiviral human OLFM3 sgRNA gene knockout kit - Lentiviral human OLFM3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
PABP2 Rabbit pAb, BF700 conjugated
orb2871731 100 µL

PABP2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
USP1
CSB-CL025695HU 10 μg Plasmid + 200 μL Glycerol

USP1

Sign In for Pricing
View Details
OSGEP siRNA (Mouse)
orb1842764-01 15 nmol

OSGEP siRNA (Mouse)

Sign In for Pricing
View Details