Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRA2B protein

This Human TRA2B protein spans the amino acid sequence from region 111-201aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Splicing factor, arginine/serine-rich 10 (Transformer-2 protein homolog B) (SFRS10)

UniProt

P62995

Expression Region

111-201aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p12 antibody - serum
CRB2005300-01 20 µL

Anti-p12 antibody - serum

Sign In for Pricing
View Details
Anti-p12 antibody - serum
CRB2005300-02 100 µL

Anti-p12 antibody - serum

Sign In for Pricing
View Details
HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (AP)
MBS6269638-01 0.1 mL

HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (AP)

Sign In for Pricing
View Details
HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (AP)
MBS6269638-02 5x 0.1 mL

HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (AP)

Sign In for Pricing
View Details
BOLL (Bol, Boule-like (Drosophila)) (MaxLight 550)
MBS6216036-01 0.1 mL

BOLL (Bol, Boule-like (Drosophila)) (MaxLight 550)

Sign In for Pricing
View Details
BOLL (Bol, Boule-like (Drosophila)) (MaxLight 550)
MBS6216036-02 5x 0.1 mL

BOLL (Bol, Boule-like (Drosophila)) (MaxLight 550)

Sign In for Pricing
View Details