Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBMX protein

This Human RBMX protein spans the amino acid sequence from region 333-391aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) (HNRPG) (RBMXP1)

UniProt

P38159

Expression Region

333-391aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Complement Component 1 Q Receptor ELISA kit
GTR10430726 96 Well

Rat Complement Component 1 Q Receptor ELISA kit

Sign In for Pricing
View Details
Olr877 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV632023 1.0 µg DNA

Olr877 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Prss3 Mouse qPCR Primer Pair (NM_011645)
MP211846 200 Reactions

Prss3 Mouse qPCR Primer Pair (NM_011645)

Sign In for Pricing
View Details
STAT2 Mouse Monoclonal Antibody
AMM83661-01 1 Each

STAT2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
STAT2 Mouse Monoclonal Antibody
AMM83661-02 50 µL

STAT2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
STAT2 Mouse Monoclonal Antibody
AMM83661-03 100 µL

STAT2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details