Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RBMX protein

This Human RBMX protein spans the amino acid sequence from region 333-391aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) (HNRPG) (RBMXP1)

UniProt

P38159

Expression Region

333-391aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human CNDP1 Protein, C-hFc & C-His (HEK293)
orb3162870-01 20 µg

Recombinant human CNDP1 Protein, C-hFc & C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human CNDP1 Protein, C-hFc & C-His (HEK293)
orb3162870-02 50 µg

Recombinant human CNDP1 Protein, C-hFc & C-His (HEK293)

Sign In for Pricing
View Details
Recombinant human CNDP1 Protein, C-hFc & C-His (HEK293)
orb3162870-03 100 µg

Recombinant human CNDP1 Protein, C-hFc & C-His (HEK293)

Sign In for Pricing
View Details
Porcine SH3 domain-binding glutamic acid-rich-like protein 3 ELISA Kit
GTR10314401 96 Well

Porcine SH3 domain-binding glutamic acid-rich-like protein 3 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human OR13C3 shRNA (UAS) - Lentiviral human OR13C3 shRNA (UAS, RFP) plasmid
GTR15082429 1 Vial

Lentiviral human OR13C3 shRNA (UAS) - Lentiviral human OR13C3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human BMSC Differentiation Bundle
BR1011 n/a

Human BMSC Differentiation Bundle

Sign In for Pricing
View Details